PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID SapurV1A.0166s0460.4.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Malpighiales; Salicaceae; Saliceae; Salix
Family NAC
Protein Properties Length: 346aa    MW: 39654.1 Da    PI: 4.844
Description NAC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
SapurV1A.0166s0460.4.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NAM177.83e-5591381129
                     NAM   1 lppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLpk...kvkaeekewyfFskrdkkyatgkrknratksgyWk 84 
                             +ppGfrFhPtdeelv +yL+kkv+++k++l +vi+++d+y++ePwdL++     ++e++ewyfFs++dkky+tg+r+nrat +g+Wk
  SapurV1A.0166s0460.4.p   9 VPPGFRFHPTDEELVGYYLRKKVASQKIDL-DVIRDIDLYRIEPWDLQErcrIGYEEQNEWYFFSHKDKKYPTGTRTNRATMAGFWK 94 
                             69****************************.9***************953432233667**************************** PP

                     NAM  85 atgkdkevlskkgelvglkktLvfykgrapkgektdWvmheyrle 129
                             atg+dk+v++ k++l+g++ktLvfykgrap+g+k+dW+mheyrle
  SapurV1A.0166s0460.4.p  95 ATGRDKSVYD-KTKLIGMRKTLVFYKGRAPNGQKSDWIMHEYRLE 138
                             **********.999*****************************85 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019412.62E-605158IPR003441NAC domain
PROSITE profilePS5100559.4059158IPR003441NAC domain
PfamPF023656.8E-2910137IPR003441NAC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 346 aa     Download sequence    Send to blast
MMESMESCVP PGFRFHPTDE ELVGYYLRKK VASQKIDLDV IRDIDLYRIE PWDLQERCRI  60
GYEEQNEWYF FSHKDKKYPT GTRTNRATMA GFWKATGRDK SVYDKTKLIG MRKTLVFYKG  120
RAPNGQKSDW IMHEYRLESD ENGPPQEEGW VVCRAFKKRA TGQNKSIEGW DSSYFYEESS  180
GVSSVVDPID YIARQPQNFL AQNFLCKQET EGDNLSFMHS ENYVQLPQLE SPSLPLIKRP  240
SSSISLISEN NNSNREEEEQ NRMLSGNSAQ KVTDWRALDK FVASQLSQED RYDGDGVSSF  300
VGAENNSSDM PLLLLQSGRD EGNNKFNGLL SSSPDCDFGI CIFEK*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
3ulx_A3e-50615912169Stress-induced transcription factor NAC1
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAB5999320.0AB599932.1 Populus trichocarpa PtVNS01 mRNA for transcription factor, complete cds.
GenBankHQ2158550.0HQ215855.1 Populus trichocarpa wood-associated NAC domain transcription factor 5A (WND5A) mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_002310297.10.0hypothetical protein POPTR_0007s13910g
RefseqXP_011025924.10.0PREDICTED: NAC domain-containing protein 7-like isoform X2
SwissprotQ9SL411e-173NAC37_ARATH; NAC domain-containing protein 37
TrEMBLE5KUH90.0E5KUH9_POPTR; Transcription factor
STRINGPOPTR_0007s13910.10.0(Populus trichocarpa)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G18060.11e-150vascular related NAC-domain protein 1